Bacterial taxon 1392858
Locus CO715_19335
Protein ATI07680.1
2-Cys peroxiredoxin
Escherichia coli M12
Length 168 aa, Gene n/a, UniProt n/a
>ATI07680.1|Escherichia coli M12|2-Cys peroxiredoxin
MSQTVHFQGNPVTVANSIPQAGSKAQTFTLVAKDLSDVTLGQFAGKRKVLNIFPSIDTGVCAASVRKFNQLATEIDNTVVLCISADLPFAQSRFCGAEGLNNVITLSTFRNAEFLQAYGVAIADGPLKGLAARAVVVIDENDNVIFSQLVDEITTEPDYEAALAVLKA
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -8.01 | 6.6e-20 | ●●○○○ -1.12 | -1.1249287976011437 | 29101196 |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -2.95 | 8.8e-5 | ●○○○○ -0.07 | -0.06917996550190557 | 29101196 |
Retrieved 2 of 2 entries in 0.6 ms
(Link to these results)