Bacterial taxon 1392858
Locus CO715_22725
Protein ATI08292.1
2-deoxyribose-5-phosphate aldolase
Escherichia coli M12
Length 259 aa, Gene n/a, UniProt n/a
>ATI08292.1|Escherichia coli M12|2-deoxyribose-5-phosphate aldolase
MTDLKASSLRALKLMDLTTLNDDDTDEKVIALCHQAKTPVGNTAAICIYPRFIPIARKTLKEQGTPEIRIATVTNFPHGNDDIEIALAETRAAIAYGADEVDVVFPYRALMAGNEQVGFDLVKACKEACAAANVLLKVIIETGELKDEALIRKASEISIKAGADFIKTSTGKVAVNATPESARIMMEVIRDMGVEKTVGFKPAGGVRTAEDAQKYLAIADELFGADWADARHYRFGASSLLASLLKALGHGDGKSASSY
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -12.11 | 2.6e-13 | ●●○○○ -1.98 | -1.9803774560214746 | 29101196 |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -10.23 | 2.3e-16 | ●●○○○ -1.59 | -1.58728836517662 | 29101196 |
Retrieved 2 of 2 entries in 0.8 ms
(Link to these results)