Bacterial taxon 1392858
Locus CO715_11590
Protein ATI06291.1
23S rRNA (guanine(745)-N(1))-methyltransferase
Escherichia coli M12
Length 269 aa, Gene n/a, UniProt n/a
>ATI06291.1|Escherichia coli M12|23S rRNA (guanine(745)-N(1))-methyltransferase
MSFSCPLCHQPLSREKNSYICPQRHQFDMAKEGYVNLLPVQHKRSRDPGDSAEMMQARRAFLDAGHYQPLRDAIVAQLRERLDEKATAVLDIGCGEGYYTHAFADALPEITTFGLDVSKVAIKAAAKRYPQVTFCVASSHRLPFSDTSMDAIIRIYAPCKAEELARVVKPGGWVITATPGPRHLMELKGLIYNEVHLHAPHAEQLEGFTLQQSDELCYPMRLRGDEAVALLQMTPFAWRAKPEVWQTLAAKEVFDCQTDFNIHLWQRSY
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -10.35 | 1.8e-16 | ●●○○○ -1.61 | -1.613160470943479 | 29101196 |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -8.46 | 7.0e-19 | ●●○○○ -1.22 | -1.2186108579988824 | 29101196 |
Retrieved 2 of 2 entries in 0.4 ms
(Link to these results)