Bacterial taxon 1392858
Locus CO715_00440
Protein ATI04335.1
3-keto-L-gulonate-6-phosphate decarboxylase
Escherichia coli M12
Length 220 aa, Gene n/a, UniProt n/a
>ATI04335.1|Escherichia coli M12|3-keto-L-gulonate-6-phosphate decarboxylase
MSRPLLQLALDHSSLEDAQRDVTLLKDSVDIVEAGTILCLNEGLGAVKALREQCPDKIIVADWKVADAGETLAQQAFGAGANWMTIICAAPLATVEKGHAMAQRCGGEIQIELFGNWTLDDARDWHRIGVRQAIYHRGRDAQASGQQWCEADLARMKALSDIGLELSITGGITPADLPLFKDIRVKAFIAGRALAGAANPAQVAGDFHAQIDAIWGGARA
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -2.21 | 0.001 | ○○○○○ 0.08 | 0.08459214699950511 | 29101196 |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | 2.83 | 2.8e-29 | ○○○○○ 1.14 | 1.137419934899259 | 29101196 |
Retrieved 2 of 2 entries in 0.9 ms
(Link to these results)