Bacterial taxon 1392858
Locus CO715_03765
Protein ATI04934.1
4-amino-4-deoxy-L-arabinose-phospho-UDP flippase
Escherichia coli M12
Length 128 aa, Gene n/a, UniProt n/a
>ATI04934.1|Escherichia coli M12|4-amino-4-deoxy-L-arabinose-phospho-UDP flippase
MGLMWGLFSVIIASAAQLSLGFAASHLPPMTHLWDFIAALLAFGLDARILLLGLLGYLLSVFCWYKTLHKLALSKAYALLSMSYVLVWIASMILPGWEGTFSLKALLGVACIMSGLMLIFLPTTKQRY
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | 2.46 | 0.045 | ○○○○○ 1.06 | 1.0583430954989406 | 29101196 |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | 10.6 | 2.1e-22 | ○○○○○ 2.76 | 2.757347589527418 | 29101196 |
Retrieved 2 of 2 entries in 0.6 ms
(Link to these results)