Bacterial taxon 1392858
Locus CO715_07995
Protein ATI05657.1
5-(carboxyamino)imidazole ribonucleotide mutase
Escherichia coli M12
Length 169 aa, Gene n/a, UniProt n/a
>ATI05657.1|Escherichia coli M12|5-(carboxyamino)imidazole ribonucleotide mutase
MSSRNNPARVAIVMGSKSDWATMQFAAEIFEILNVPHHVEVVSAHRTPDKLFSFAESAEENGYQVIIAGAGGAAHLPGMIAAKTLVPVLGVPVQSAALSGVDSLYSIVQMPRGIPVGTLAIGKAGAANAALLAAQILATHDKELHQRLNDWRKAQTDEVLENPDPRGAA
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -11.77 | 2.1e-33 | ●●○○○ -1.91 | -1.9102723952338572 | 29101196 |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -8.88 | 1.0e-45 | ●●○○○ -1.31 | -1.3072854140546482 | 29101196 |
Retrieved 2 of 2 entries in 1.7 ms
(Link to these results)