Bacterial taxon 1392858
Locus CO715_08000
Protein ATI05658.1
5-(carboxyamino)imidazole ribonucleotide synthase
Escherichia coli M12
Length 355 aa, Gene n/a, UniProt n/a
>ATI05658.1|Escherichia coli M12|5-(carboxyamino)imidazole ribonucleotide synthase
MKQVCVLGNGQLGRMLRQAGEPLGIAVWPVGLDAEPAAVPFQQSVITAEIERWPETALTRELARHPAFVNRDVFPIIADRLTQKQLFDKLHLPTAPWQLLADRSEWPAVFDRLGELAIVKRRTGGYDGRGQWRLRADETEQLPAECYGECIVEQGINFSGEVSLVGARGFDGSTVFYPLTHNLHQDGILRTSVAFPQANAQQQAQAEEMLSAIMQELGYVGVMAMECFVTPQGLLINELAPRVHNSGHWTQNGASISQFELHLRAITDLPLPQPVVNSPSVMINLIGSDVNYDWLKLPLVHLHWYDKEVRPGRKVGHLNLTDSDTSRLTATLEALIPLLPPEYASGVIWAQSKFS
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -12.33 | 1.7e-5 | ●●●○○ -2.03 | -2.0271141632132195 | 29101196 |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -8.07 | 0.0028 | ●●○○○ -1.14 | -1.1374475584560755 | 29101196 |
Retrieved 2 of 2 entries in 0.4 ms
(Link to these results)