Bacterial taxon 1392858
Locus CO715_18965
Protein ATI07612.1
acetyltransferase
Escherichia coli M12
Length 269 aa, Gene n/a, UniProt n/a
>ATI07612.1|Escherichia coli M12|acetyltransferase
MKVQLYKFTEDKNKTLTFRWTKKHFEFCMDNKIFLNHKGKKSYKERNLFLFSKGDKITIEDNVIAEEYSTMPVKNFSSVGAFSFPTCHFTGNIHIGRFCSIASNVKIMGGNHPLNRFTTHMMTYNGEFDKFAKSEFERSWTLKPFITKPENPIIGNDVWIGNDVVLKGGIAIGDGAVIAANSVVTKDVPPYAIVAGVPAKIIRFRFDSNVIDELLRIKWWNYNYSDLPDNNKCDDINYFVEEMNRLISNGNIQEMDYKKFNLSEIFRDL
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -9.28 | 2.5e-15 | ●●○○○ -1.39 | -1.3892832976544507 | 29101196 |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -8.41 | 4.5e-14 | ●●○○○ -1.21 | -1.2094304333719323 | 29101196 |
Retrieved 2 of 2 entries in 0.7 ms
(Link to these results)