Bacterial taxon 1392858
Locus CO715_14280
Protein ATI06771.1
acid stress chaperone HdeA
Escherichia coli M12
Length 110 aa, Gene n/a, UniProt n/a
>ATI06771.1|Escherichia coli M12|acid stress chaperone HdeA
MKKVLGVILGGLLLLPVVSNAADAQKAADNKKPVNSWTCEDFLAVDESFQPTAVGFAEALNNKDKPEDAVLDVQGIATVTPAIVQACTQDKQANFKDKVKGEWDKIKKDM
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | 1.46 | 4.9e-16 | ○○○○○ 0.85 | 0.8515748953783192 | 29101196 |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | 2.36 | 6.2e-38 | ○○○○○ 1.04 | 1.0385217241452986 | 29101196 |
Retrieved 2 of 2 entries in 1.7 ms
(Link to these results)