Bacterial taxon 1392858
Locus CO715_00405
Protein ATI04328.1
addiction module toxin, HicA family
Escherichia coli M12
Length 61 aa, Gene n/a, UniProt n/a
>ATI04328.1|Escherichia coli M12|addiction module toxin, HicA family
MKSADVIAILKQHGWEHIRTRGSHHQFRHPVHPGLVTVPHPKKDIKPGTLAQIGRQAGLTF
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -9.06 | 1.8e-10 | ●●○○○ -1.34 | -1.3446330506051944 | 29101196 |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -4.72 | 9.3e-6 | ●○○○○ -0.44 | -0.4380661186938922 | 29101196 |
Retrieved 2 of 2 entries in 0.7 ms
(Link to these results)