Bacterial taxon 1392858
Locus CO715_17125
Protein ATI07287.1
adenylyl-sulfate kinase
Escherichia coli M12
Length 201 aa, Gene n/a, UniProt n/a
>ATI07287.1|Escherichia coli M12|adenylyl-sulfate kinase
MALHDENVVWHSHPVTVQQRELHHGHRGVVLWFTGLSGSGKSTVAGALEEALHKLGVSTYLLDGDNVRHGLCSDLGFSDADRKENIRRVGEVANLMVEAGLVVLTAFISPHRAERQMVRERVGEGRFIEVFVDTPLAICEARDPKGLYKKARAGELRNFTGIDSVYEAPESAEIHLNGEQLVTNLVQQLLDLLRQNDIIRS
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -11.44 | 0.00094 | ●●○○○ -1.84 | -1.841419210531733 | 29101196 |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -11.02 | 0.0025 | ●●○○○ -1.75 | -1.7537878845472112 | 29101196 |
Retrieved 2 of 2 entries in 0.7 ms
(Link to these results)