Bacterial taxon 1392858
Locus CO715_23610
Protein ATI08433.1
Ail/Lom family protein
Escherichia coli M12
Length 199 aa, Gene n/a, UniProt n/a
>ATI08433.1|Escherichia coli M12|Ail/Lom family protein
MRKLYAAILSAAICLAVSGAPAWASEHQSTLSAGYLHASTNVPGSDDLNGINVKYRYEFTDTLGLVTSFSYAGDKNRQLTRYSDTRWHEDSVRNRWFSVMAGPSVRVNEWFSAYAMAGVAYSRVSTFSGDYLRVTDNKGKTHDVLTGSDDGRHSNTSLAWGAGVQFNPTESVAIDIAYEGSGSGDWRTDGFIVGVGYKF
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | 3.06 | 0.0013 | ○○○○○ 1.19 | 1.1851998721622483 | 29101196 |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | 7.24 | 1.1e-15 | ○○○○○ 2.06 | 2.056714273679742 | 29101196 |
Retrieved 2 of 2 entries in 0.4 ms
(Link to these results)