Bacterial taxon 1392858
Locus CO715_09450
Protein ATI05917.1
alpha/beta hydrolase
Escherichia coli M12
Length 254 aa, Gene n/a, UniProt n/a
>ATI05917.1|Escherichia coli M12|alpha/beta hydrolase
MKLNIRAQTAQNQHNNSPIVLVHGLFGSLDNLGVLARDLVNDHNIIQVDMRNHGLSPRDPVMNYPAMAQDLVDTLDAQQIDKATFIGHSMGGKAVMALTALAPDRIDKLVAIDIAPVDYHVRRHDEIFAAINAVSESDAQTRQQAAAIMRQHLNEEGVIQFLLKSFVDGEWRFNVPVLWEQYPHIVGWEKIPAWDLPALFIPGGNSPYVSEQYRDDLLAQFPQARAHVIAGAGHWVHAEKPDAVLRAIRRYLND
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -8.27 | 3.4e-10 | ●●○○○ -1.18 | -1.1789681152915987 | 29101196 |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | 3.6 | 1.1e-6 | ○○○○○ 1.3 | 1.2972427818138867 | 29101196 |
Retrieved 2 of 2 entries in 0.7 ms
(Link to these results)