Bacterial taxon 1392858
Locus CO715_03535
Protein ATI04891.1
amino acid ABC transporter permease
Escherichia coli M12
Length 238 aa, Gene n/a, UniProt n/a
>ATI04891.1|Escherichia coli M12|amino acid ABC transporter permease
MIEILHEYWKPLLWTDGYRFTGVAITLWLLILSVVIGGVMALFLAIGRVSSNKYIQFPIWLFTYIFRGTPLYVQLLVFYSGMYTLEIVKGTEFLNAFFRSGLNCTVLALTLNTCAYTTEIFAGAIRSVPHGEIEAARAYGFSTFKMYRCIILPSALRIALPAYSNEVILMLHSTALAFTATVPDLLKIARDINAATYQPFTAFGIAAVLYLIISYVLISLFRRAEKRWLQHVKPSSTH
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -7.79 | 2.3e-18 | ●●○○○ -1.08 | -1.0798612585233895 | 29101196 |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -1.39 | 0.0041 | ○○○○○ 0.26 | 0.2567251087548157 | 29101196 |
Retrieved 2 of 2 entries in 0.6 ms
(Link to these results)