Bacterial taxon 1392858
Locus CO715_05170
Protein ATI05174.1
amino acid ABC transporter permease
Escherichia coli M12
Length 222 aa, Gene n/a, UniProt n/a
>ATI05174.1|Escherichia coli M12|amino acid ABC transporter permease
MQESIQLVIDSLPFLLKGAGYTLQLSIGGMFFGLLLGFILALMRLSPIWPVRWLARFYISIFRGTPLIAQLFMIYYGLPQFGIELDPIPSAMIGLSLNTAAYAAETLRAAISSIDKGQWEAAASIGMTPWQTMRRAILPQAARVALPPLSNSFISLVKDTSLAATIQVPELFRQAQLITSRTLEVFTMYLAASLIYWIMATVLSTLQNHFENQLNRQEREPK
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -7.94 | 0.0003 | ●●○○○ -1.11 | -1.1105322226179721 | 29101196 |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -7.52 | 0.0011 | ●●○○○ -1.02 | -1.0229008966334503 | 29101196 |
Retrieved 2 of 2 entries in 0.8 ms
(Link to these results)