Bacterial taxon 1392858
Locus CO715_13390
Protein ATI06615.1
amino acid ABC transporter substrate-binding protein
Escherichia coli M12
Length 341 aa, Gene n/a, UniProt n/a
>ATI06615.1|Escherichia coli M12|amino acid ABC transporter substrate-binding protein
MKKMMIATLAAASVLLAVANQAHAGATLDAVQKKGFVQCGISDGLPGFSYADADGKFSGIDVDVCRGVAAAVFGDDTKVKYTPLTAKERFTALQSGEVDLLSRNTTWTSSRDAGMGMAFTGVTYYDGIGFLTHDKAGLKSAKELDGATVCIQAGTDTELNVADYFKANNMKYTPVTFDRSDESAKALESGRCDTLASDQSQLYALRIKLSNPAEWIVLPEVISKEPLGPVVRRGDDEWFSIVRWTLFAMLNAEEMGINSQNVDEKAANPATPDMAHLLGKEGDYGKDLKLDNKWAYNIIKQVGNYSEIFERNVGSESPLKIKRGQNNLWNNGGIQYAPPVR
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | 1.8 | 0.021 | ○○○○○ 0.92 | 0.9208453721089411 | 29101196 |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | 5.28 | 2.2e-13 | ○○○○○ 1.65 | 1.647350793723476 | 29101196 |
Retrieved 2 of 2 entries in 0.7 ms
(Link to these results)