Bacterial taxon 1392858
Locus CO715_04100
Protein ATI04996.1
aminodeoxychorismate synthase component 2
Escherichia coli M12
Length 187 aa, Gene n/a, UniProt n/a
>ATI04996.1|Escherichia coli M12|aminodeoxychorismate synthase component 2
MILLIDNYDSFTWNLYQYFCELGADVLVKRNDALTLADIDALKPQKIVISPGPCTPDEAGISLDVIRNYAGCLPILGVCLGHQAMAQAFGGKVVRAAKVMHGKTSPITHNGEGVFRGLANPLTVTRYHSLVVEPDSLPACFEVTAWSETREIMGIRHRQWDLEGVQFHPESILSEQGHQLLANFLHR
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -9.67 | 4.0e-27 | ●●○○○ -1.47 | -1.4710725352400043 | 29101196 |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -8.29 | 3.3e-33 | ●●○○○ -1.18 | -1.18418426564782 | 29101196 |
Retrieved 2 of 2 entries in 0.9 ms
(Link to these results)