Bacterial taxon 1392858
Locus CO715_13755
Protein ATI06677.1
anaerobic ribonucleoside-triphosphate reductase-activating protein
Escherichia coli M12
Length 154 aa, Gene n/a, UniProt n/a
>ATI06677.1|Escherichia coli M12|anaerobic ribonucleoside-triphosphate reductase-activating protein
MNYHQYYPVDIVNGPGTRCTLFVSGCVHECPGCYNKSTWRVNSGQPFTKAMEDQIINDLNDTRIKRQGISLSGGDPLHPQNVPDILKLVKRIRAECPDKDIWVWTGYKLDDLNAAQMQVVDLINVLVDGKFVQDLKDPSLIWRGSSNQVVHHLR
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -8.48 | 9.5e-13 | ●●○○○ -1.22 | -1.2236183623408547 | 29101196 |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -5.37 | 5.7e-7 | ●○○○○ -0.58 | -0.5751465500553941 | 29101196 |
Retrieved 2 of 2 entries in 1 ms
(Link to these results)