Bacterial taxon 1392858
Locus CO715_00130
Protein ATI04281.1
ancillary SecYEG translocon subunit
Escherichia coli M12
Length 206 aa, Gene n/a, UniProt n/a
>ATI04281.1|Escherichia coli M12|ancillary SecYEG translocon subunit
MEIYENENDQVEAVKRFFAENGKALAVGVILGVGALIGWRYWNSHQVDSARSASLAYQNAVTAVSEGKPDSIPAAEKFAAENKNTYGALASLELAQQFVDKNELEKAAAQLQQGLADTSDENLKAVINLRLARVQVQLKQADAALKTLDTIKGEGWAAIVADLRGEALLSKGDKQGARSAWEAGVKSDVTPALSEMMQMKINNLSI
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -11.69 | 2.7e-14 | ●●○○○ -1.89 | -1.8933720680796997 | 29101196 |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -3.78 | 1.2e-9 | ●○○○○ -0.24 | -0.2433993873997047 | 29101196 |
Retrieved 2 of 2 entries in 0.6 ms
(Link to these results)