Bacterial taxon 1392858
Locus CO715_00200
Protein ATI04293.1
anti-sigma-E factor RseA
Escherichia coli M12
Length 216 aa, Gene n/a, UniProt n/a
>ATI04293.1|Escherichia coli M12|anti-sigma-E factor RseA
MQKEQLSALMDGETLDSELLNELAHNPEMQKTWESYHLIRDSMRGDTPEVLHFDISSRVMAAIEEEPVRQPATLIPEAQPAPHQWQKMPFWQKVRPWAAQLTQMGVAACVSLAVIVGVQHYNGQSETSQQPETPVFNTLPMMGKASPVSLGVPSEATANNGQQQQVQEQRRRINAMLQDYELQRRLHSEQLQFEQAQTQQAAVQVPGIQTLGTQSQ
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -9.13 | 0.00011 | ●●○○○ -1.36 | -1.3596555636311125 | 29101196 |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -7.9 | 0.00055 | ●●○○○ -1.1 | -1.1030209661050132 | 29101196 |
Retrieved 2 of 2 entries in 0.7 ms
(Link to these results)