Bacterial taxon 1392858
Locus CO715_25145
Protein ATI08677.1
antirestriction protein
Escherichia coli M12
Length 115 aa, Gene n/a, UniProt n/a
>ATI08677.1|Escherichia coli M12|antirestriction protein
MPQWVTLEPRVFGWMDRLCEDYCGGIWNLYTLNNGGAFMAPEPDDDDDENWVLFNAMNGNRAEMSPEAAGIAACLMTYSHHACRTECYAMTIHYYRLRDYALQHPECSAIMRIID
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -4.41 | 5.4e-12 | ●○○○○ -0.37 | -0.3733858542767453 | 29101196 |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | 3.13 | 1.7e-6 | ○○○○○ 1.2 | 1.1987618630884243 | 29101196 |
Retrieved 2 of 2 entries in 0.6 ms
(Link to these results)