Bacterial taxon 1392858
Locus CO715_06990
Protein ATI05482.1
antitermination protein
Escherichia coli M12
Length 125 aa, Gene n/a, UniProt n/a
>ATI05482.1|Escherichia coli M12|antitermination protein
MRDIQMVLERWGAWAANNHEDVTWSSIAAGFKGLIPSKVKSRPQCCDDDAMIICGCMARLKNNNSDLHDLLVDYYVGGMTFMALARKHGRSDCWIGRMLQKAEGVVEGMLMVLDLRLEMDADCLR
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -12.02 | 2.0e-90 | ●●○○○ -1.96 | -1.9613906687248286 | 29101196 |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -8.84 | 4.0e-167 | ●●○○○ -1.3 | -1.298522281456196 | 29101196 |
Retrieved 2 of 2 entries in 1.4 ms
(Link to these results)