Bacterial taxon 1392858
Locus CO715_06215
Protein ATI05349.1
AraC family transcriptional regulator
Escherichia coli M12
Length 84 aa, Gene n/a, UniProt n/a
>ATI05349.1|Escherichia coli M12|AraC family transcriptional regulator
MQMNTPSFHQHFRQLAGMSPLRYQKWLRLNEARRLMLNEHYDVTTAAYAVGYESLSHFSREYSRMFGESPKRDIARLRKSVDQL
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -12.03 | 5.4e-14 | ●●○○○ -1.96 | -1.9643117129243124 | 29101196 |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -8.24 | 1.5e-15 | ●●○○○ -1.17 | -1.1729173808783817 | 29101196 |
Retrieved 2 of 2 entries in 1 ms
(Link to these results)