Bacterial taxon 1392858
Locus CO715_14240
Protein ATI06763.1
AraC family transcriptional regulator
Escherichia coli M12
Length 274 aa, Gene n/a, UniProt n/a
>ATI06763.1|Escherichia coli M12|AraC family transcriptional regulator
MQSLHGNCLIAYARHKYILTMVNGEYRYFNGGDLVFADASQIRVDKCGEHFILVSRDTLSLFLPMLKEEALKLHAHKKVPSLLVHHCTRDIPVFQEVAQLSQNKNLRYAETLRKRALIFALLSVFLEDEQFIPLLLNVLQPNMRTRVCTVINNNIAHEWTLARIASELLMSPSLLKKKLREEETSYSQLLTECRMQHALQLIVIHGFSIKRVAVSCGYHSVSYFIYVFRNYYGMTPTEYQERSAQGLSNRDSAASIVAQGNFYGTDCSAEGIRL
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | 1.82 | 6.3e-18 | ○○○○○ 0.92 | 0.9248096463796693 | 29101196 |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | 2.07 | 5.4e-22 | ○○○○○ 0.98 | 0.9778057339988802 | 29101196 |
Retrieved 2 of 2 entries in 0.8 ms
(Link to these results)