Bacterial taxon 1392858
Locus CO715_14370
Protein ATI06787.1
ArsR family transcriptional regulator
Escherichia coli M12
Length 98 aa, Gene n/a, UniProt n/a
>ATI06787.1|Escherichia coli M12|ArsR family transcriptional regulator
MQLEEVAKALKELGHPTRLFIFKHLVKAGEQGLPVGELQKQLGIPGSTLSHHISALVSVGLVKQNRESRTLMCVSQYAMLEAIIEFLREECCVNSKIA
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -7.76 | 2.9e-83 | ●●○○○ -1.07 | -1.073184586067426 | 29101196 |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -0.94 | 0.0002 | ○○○○○ 0.35 | 0.3493639390813101 | 29101196 |
Retrieved 2 of 2 entries in 0.5 ms
(Link to these results)