Bacterial taxon 1392858
Locus CO715_06110
Protein ATI05328.1
autoinducer 2-degrading protein LsrG
Escherichia coli M12
Length 96 aa, Gene n/a, UniProt n/a
>ATI05328.1|Escherichia coli M12|autoinducer 2-degrading protein LsrG
MHVTLVEINVHEDKVDEFIEVFRQNHLGSVQEEGNLRFDVLQDPEVNSRFYIYEAYKDEDAVAFHKTTPHYKTCVAKLESLMTGPRKKRLFNGLMP
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -8.27 | 4.2e-17 | ●●○○○ -1.18 | -1.1798026993485942 | 29101196 |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | 2.51 | 3.0e-7 | ○○○○○ 1.07 | 1.0689840422256327 | 29101196 |
Retrieved 2 of 2 entries in 0.9 ms
(Link to these results)