Bacterial taxon 1392858
Locus CO715_00610
Protein ATI04368.1
autotransporter outer membrane beta-barrel domain-containing protein
Escherichia coli M12
Length 232 aa, Gene n/a, UniProt n/a
>ATI04368.1|Escherichia coli M12|autotransporter outer membrane beta-barrel domain-containing protein
MIIKKSGGRWQLSLLASVVISAFFLNTAYAWQQEYIVDTQPGHSTERYTWDSDHQPDYNDILSQRIQSSQRALGLEVNLAEETPVDVTSSMSMGWNFPLYEQVTTGPVAALHYDGTTTSMYNEFGDSTTTLADPLWHASVSTLGWRVDSRLGDLRPWAQISYNQQFGENIWKAQSGLSRMTATNQNGNWLDVTVGADMLLNQNIAAYAALSQTENTTNNSDYLYTMGVSARF
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -7.95 | 7.2e-27 | ●●○○○ -1.11 | -1.1124100367462118 | 29101196 |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -5.17 | 1.1e-14 | ●○○○○ -0.53 | -0.5321654711201288 | 29101196 |
Retrieved 2 of 2 entries in 1 ms
(Link to these results)