Bacterial taxon 1392858
Locus CO715_11905
Protein ATI06349.1
biopolymer transporter ExbD
Escherichia coli M12
Length 141 aa, Gene n/a, UniProt n/a
>ATI06349.1|Escherichia coli M12|biopolymer transporter ExbD
MAMHLNENLDDNGEMHDINVTPFIDVMLVLLIIFMVAAPLATVDVKVNLPASTSTPQPRPEKPVYLSVKADNSMFIGNDPVTDETMITALNALTEGKKDTTIFFRADKTVDYETLMKVMDTLHQAGYLKIGLVGEETAKAK
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -10.64 | 0.0062 | ●●○○○ -1.67 | -1.674711045146893 | 29101196 |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -10.22 | 0.014 | ●●○○○ -1.59 | -1.5870797191623713 | 29101196 |
Retrieved 2 of 2 entries in 0.6 ms
(Link to these results)