Bacterial taxon 1392858
Locus CO715_16080
Protein ATI07096.1
carbonic anhydrase
Escherichia coli M12
Length 220 aa, Gene n/a, UniProt n/a
>ATI07096.1|Escherichia coli M12|carbonic anhydrase
MKDIDTLISNNALWSKMLVEEDPGFFEKLAQAQKPRFLWIGCSDSRVPAERLTGLEPGELFVHRNVANLVIHTDLNCLSVVQYAVDVLEVEHIIICGHYGCGGVQAAVENPELGLINNWLLHIRDIWFKHSSLLGEMPQERRLDTLCELNVMEQVYNLGHSTIMQSAWKRGQKVTIHGWAYGIHDGLLRDLDVTATNRETLEQRYRHGISNLKLKHANHK
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -7.9 | 1.8e-10 | ●●○○○ -1.1 | -1.1023950280622665 | 29101196 |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -4.69 | 1.5e-8 | ●○○○○ -0.43 | -0.43326726036616847 | 29101196 |
Retrieved 2 of 2 entries in 1 ms
(Link to these results)