Bacterial taxon 1392858
Locus CO715_05200
Protein ATI05180.1
CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase
Escherichia coli M12
Length 182 aa, Gene n/a, UniProt n/a
>ATI05180.1|Escherichia coli M12|CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase
MQFNIPTLLTLFRVILIPFFVLVFYLPVTWSPFAAALIFCVAAVTDWFDGFLARRWNQSTRFGAFLDPVADKVLVAIAMVLVTEHYHSWWVTLPAATMIAREIIISALREWMAELGKRSSVAVSWIGKVKTTAQMVALAWLLWRPNIWVEYAGIALFFVAAVLTLWSMLQYLSAARADLLDQ
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -1.68 | 6.2e-8 | ○○○○○ 0.2 | 0.19517453455140163 | 29101196 |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | 0.45 | 0.047 | ○○○○○ 0.64 | 0.6408424209869693 | 29101196 |
Retrieved 2 of 2 entries in 0.9 ms
(Link to these results)