Bacterial taxon 1392858
Locus CO715_02545
Protein ATI04711.1
CesD/SycD/LcrH family type III secretion system chaperone
Escherichia coli M12
Length 165 aa, Gene n/a, UniProt n/a
>ATI04711.1|Escherichia coli M12|CesD/SycD/LcrH family type III secretion system chaperone
MESANLDLEENKEIASKFERALGMGATLAELHGITPDTLEGVYAYAYNFYEKGRLDEAELFFKFLCIYDFQNYNYLKGYAAVCQLKKDYQKAFDMYHICLMLSPDNDFSLVYYMGQCQMGLKNTKMATELFNTVVTYSQNEKIKEMATAYLELLTANTEEEVQTE
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | 0.69 | 0.0067 | ○○○○○ 0.69 | 0.689456942306954 | 29101196 |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | 1.5 | 9.4e-9 | ○○○○○ 0.86 | 0.8592947979055269 | 29101196 |
Retrieved 2 of 2 entries in 0.7 ms
(Link to these results)