Bacterial taxon 1392858
Locus CO715_14165
Protein ATI06749.1
cobalamin-binding protein
Escherichia coli M12
Length 266 aa, Gene n/a, UniProt n/a
>ATI06749.1|Escherichia coli M12|cobalamin-binding protein
MAKSLFRALVALSFLAPLWLNAAPRVITLSPANTELAFAAGITPVGVSSYSDYPPQAQKIEQVSTWQGMNLERIVALKPDLVIAWRGGNAERQVDQLASLGIKVMWVDATSIEQIANALRQLAPWSPQPDKAEQAAQSLLDQYAQLKAQYADKPKKRVFLQFGINPPFTSGKESIQNQVLEVCGGENIFKDSRVPWPQVSREQVLARAPQAIVITGGPDQIPKIKQYWGEQLKIPVIPLTSDWFERASPRIILAAQQLCNALSQVD
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -9.28 | 1.9e-8 | ●●○○○ -1.39 | -1.3909524657684418 | 29101196 |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | 2.36 | 0.0058 | ○○○○○ 1.04 | 1.0376871400883034 | 29101196 |
Retrieved 2 of 2 entries in 0.8 ms
(Link to these results)