Bacterial taxon 1392858
Locus CO715_18180
Protein ATI08854.1
cobalt ABC transporter ATP-binding protein
Escherichia coli M12
Length 225 aa, Gene n/a, UniProt n/a
>ATI08854.1|Escherichia coli M12|cobalt ABC transporter ATP-binding protein
MVTLEQFSYCPTHSTHPPFCYDFHYVKSGMVAIFGDNGSGKSTLAQLMAGWYPDFLPGEITGTGTLLGTPIGHLPLNEQSATIQLVQQSPYLQLSGCTFSVEEEVAFGPENLCLAEEEIMARIDAALTLTECQPLRHRHPATLSGGETQRVVIACAIAMQPKLLILDEAFSRLTPQASEMLLQRLQHWAFERGSLIILFERHRTPFLNYCQQAWQLQNGALQPLC
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -7.44 | 4.5e-7 | ●●○○○ -1.01 | -1.0051659854222972 | 29101196 |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -5.56 | 8.7e-5 | ●○○○○ -0.61 | -0.6137460626914335 | 29101196 |
Retrieved 2 of 2 entries in 0.5 ms
(Link to these results)