Bacterial taxon 1392858
Locus CO715_11595
Protein ATI06292.1
cold-shock protein CspC
Escherichia coli M12
Length 69 aa, Gene n/a, UniProt n/a
>ATI06292.1|Escherichia coli M12|cold-shock protein CspC
MAKIKGQVKWFNESKGFGFITPADGSKDVFVHFSAIQGNGFKTLAEGQNVEFEIQDGQKGPAAVNVTAI
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -1.92 | 0.018 | ○○○○○ 0.15 | 0.14530813714592378 | 29101196 |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | 4.44 | 3.6e-9 | ○○○○○ 1.47 | 1.4716708497259348 | 29101196 |
Retrieved 2 of 2 entries in 0.7 ms
(Link to these results)