Bacterial taxon 1392858
Locus CO715_07305
Protein ATI05539.1
cold-shock protein CspH
Escherichia coli M12
Length 70 aa, Gene n/a, UniProt n/a
>ATI05539.1|Escherichia coli M12|cold-shock protein CspH
MSRKMTGIVKTFDRKSGKGFIIPSDGRKEVQVHISAFTPRDAEVLIPGLRVEFCRVNGLRGPTAANVYLS
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -10.81 | 2.5e-10 | ●●○○○ -1.71 | -1.7089289914837063 | 29101196 |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -3.74 | 0.00021 | ●○○○○ -0.23 | -0.2348449008155014 | 29101196 |
Retrieved 2 of 2 entries in 0.9 ms
(Link to these results)