Bacterial taxon 1392858
Locus CO715_15285
Protein ATI08825.1
CopG family transcriptional regulator
Escherichia coli M12
Length 70 aa, Gene n/a, UniProt n/a
>ATI08825.1|Escherichia coli M12|CopG family transcriptional regulator
MNTVFLHLSEEAIKRLNKLRGWRKVSRSAILREAVEQYLERQQFPVRKAKGGRQKGEVVGVDDQCKEHKE
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -1.92 | 6.5e-25 | ○○○○○ 0.15 | 0.14530813714592378 | 29101196 |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | 0.43 | 0.033 | ○○○○○ 0.64 | 0.6350003325880011 | 29101196 |
Retrieved 2 of 2 entries in 1 ms
(Link to these results)