Bacterial taxon 1392858
Locus CO715_13975
Protein ATI06716.1
copper homeostasis/adhesion lipoprotein NlpE
Escherichia coli M12
Length 236 aa, Gene n/a, UniProt n/a
>ATI06716.1|Escherichia coli M12|copper homeostasis/adhesion lipoprotein NlpE
MVKKAIVTAMAVISLFTLMGCNNRAEVDTLSPAQAAELKPMPQSWRGVLPCADCEGIETSLFLEKDGTWVMNERYLGAREEPSSFASYGTWARTADKLVLTDSKGEKSYYRAKGDALEMLDREGNPIESQFYYTLEPAQSSLPMTPMTLRGMYFYMADAATFTDCATGKRFMVANNAELERGYLAARGHSEKPMLLSVEGHFTLEANPDTGAPTKVLAPDTAGKFYPNQDCSSLGQ
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | 3.39 | 4.2e-10 | ○○○○○ 1.25 | 1.2538444108501234 | 29101196 |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | 5.42 | 1.2e-22 | ○○○○○ 1.68 | 1.6765612357183164 | 29101196 |
Retrieved 2 of 2 entries in 1.1 ms
(Link to these results)