Bacterial taxon 1392858
Locus CO715_05445
Protein ATI05222.1
crossover junction endodeoxyribonuclease RuvC
Escherichia coli M12
Length 173 aa, Gene n/a, UniProt n/a
>ATI05222.1|Escherichia coli M12|crossover junction endodeoxyribonuclease RuvC
MAIILGIDPGSRVTGYGVIRQVGRQLSYLGSGCIRTKVDDLPSRLKLIYAGVTEIITQFQPDYFAIEQVFMAKNADSALKLGQARGVAIVAAVNQELPVFEYAARQVKQTVVGIGSAEKSQVQHMVRTLLKLPANPQADAADALAIAITHCHVSQNAMQMSESRLNLARGRLR
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -9.32 | 0.011 | ●●○○○ -1.4 | -1.3974204922101563 | 29101196 |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -8.9 | 0.024 | ●●○○○ -1.31 | -1.3099978122398837 | 29101196 |
Retrieved 2 of 2 entries in 0.6 ms
(Link to these results)