Bacterial taxon 1392858
Locus CO715_22310
Protein ATI08224.1
cysteine/O-acetylserine transporter
Escherichia coli M12
Length 195 aa, Gene n/a, UniProt n/a
>ATI08224.1|Escherichia coli M12|cysteine/O-acetylserine transporter
MTPTLLSAFWTYTLITAMTPGPNNILALSSATTHGFRQSTRVLAGMSLGFLIVMLLCAGISFSLAVIDPAAVHLLSWAGAAYIVWLAWKIATSPTKEDGLQTKPISFWASFALQFVNVKIILYGITALSTFVLPQTQALSWIIGVSVLLAMIGTFGNVCWALAGHLFQRLFRQYGRQLNIVLALLLVYCAVRIFY
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -7.95 | 0.008 | ●●○○○ -1.11 | -1.1115754526892165 | 29101196 |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -7.53 | 0.019 | ●●○○○ -1.02 | -1.0239441267046947 | 29101196 |
Retrieved 2 of 2 entries in 1.1 ms
(Link to these results)