Bacterial taxon 1392858
Locus CO715_13760
Protein ATI06678.1
cytochrome b562
Escherichia coli M12
Length 128 aa, Gene n/a, UniProt n/a
>ATI06678.1|Escherichia coli M12|cytochrome b562
MRKSLLAILAVSSLVFSSASFAADLEDNMETLNDTLKVVEKADNAAQVKDALTKMRAAALDAQKATPPKLEDKSPDSPEMKDFRHGFDILVGQIDDALKLANEGKVKEAQAAAEQLKTTRNAYHQKYR
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -9.82 | 3.3e-7 | ●●○○○ -1.5 | -1.5027867294058315 | 29101196 |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -8.78 | 1.7e-6 | ●●○○○ -1.29 | -1.286420812629762 | 29101196 |
Retrieved 2 of 2 entries in 0.5 ms
(Link to these results)