Bacterial taxon 1392858
Locus CO715_12495
Protein ATI06451.1
DedA family protein
Escherichia coli M12
Length 220 aa, Gene n/a, UniProt n/a
>ATI06451.1|Escherichia coli M12|DedA family protein
MELLTQLLQALWAQDFETLANPSMIGMLYFVLFVILFLENGLLPAAFLPGDSLLVLVGVLIAKGAMGYPQTILLLTVAASLGCWVSYIQGRWLGNTRTVQNWLSHLPAHYHQRAHHLFHKHGLSALLIGRFIAFVRTLLPTIAGLSGLNNARFQFFNWMSGLLWVLILTTLGYMLGKTPVFLKYEDQLMSCLMLLPVVLLVFGLAGSLVVLWKKKYGNRG
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -7.89 | 2.9e-49 | ●●○○○ -1.1 | -1.0992653378485338 | 29101196 |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -4.68 | 3.5e-35 | ●○○○○ -0.43 | -0.4303462161666844 | 29101196 |
Retrieved 2 of 2 entries in 1 ms
(Link to these results)