Bacterial taxon 1392858
Locus CO715_19245
Protein ATI07664.1
DNA endonuclease SmrA
Escherichia coli M12
Length 187 aa, Gene n/a, UniProt n/a
>ATI07664.1|Escherichia coli M12|DNA endonuclease SmrA
MNLDDKSLFLDAMEDVQPLKRATDVHWHPTRNQRAPQRIDTLQLDNFLTTGFLDIIPLSQPLEFRREGLQHGVLDKLRSGKYPQQASLNLLRQPVEECRKMMFSFIQQAMADGLRNVLIIHGKGREDKSHANIVRSYVARWLTEFDDVQAYCTALPHHGGSGACYVALRKTAQAKQENWERHAKRSR
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -11.88 | 2.1e-12 | ●●○○○ -1.93 | -1.9332234568012319 | 29101196 |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -8.1 | 7.5e-12 | ●●○○○ -1.14 | -1.1439155848977898 | 29101196 |
Retrieved 2 of 2 entries in 1.2 ms
(Link to these results)