Bacterial taxon 1392858
Locus CO715_05085
Protein ATI05161.1
DNA gyrase inhibitor SbmC
Escherichia coli M12
Length 157 aa, Gene n/a, UniProt n/a
>ATI05161.1|Escherichia coli M12|DNA gyrase inhibitor SbmC
MNYEIKQEDKRTVAGFHLVGPWEQTVKKGFEQLMMWVDSKNIVPKEWVAVYYDNPDETPAEKLRCDTVVTVPGYFTLPENSEGVILTEISGGQYAVAVARVVGDDFAKPWYQFFNSLLQDSAYEMLPKPCFEVYLNNGAEDGYWDIEMYVAVQPKHH
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -9.71 | 2.7e-35 | ●●○○○ -1.48 | -1.480461605881203 | 29101196 |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | 2.21 | 3.5e-5 | ○○○○○ 1.01 | 1.0063902379509742 | 29101196 |
Retrieved 2 of 2 entries in 1.4 ms
(Link to these results)