Bacterial taxon 1392858
Locus CO715_23120
Protein ATI08363.1
DNA helicase
Escherichia coli M12
Length 69 aa, Gene n/a, UniProt n/a
>ATI08363.1|Escherichia coli M12|DNA helicase
MQVAQFNSHYQYDPKFERGMYLYEHRRCFNNIIDYCNSLCYHGKLQPKRGMEKGRFSPQWDIYILMVEA
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -0.65 | 0.023 | ○○○○○ 0.41 | 0.41112315929897303 | 29101196 |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | 0.88 | 0.0034 | ○○○○○ 0.73 | 0.7293083310284865 | 29101196 |
Retrieved 2 of 2 entries in 0.6 ms
(Link to these results)