Bacterial taxon 1392858
Locus CO715_03955
Protein ATI04968.1
DNA utilization protein HofM
Escherichia coli M12
Length 259 aa, Gene n/a, UniProt n/a
>ATI04968.1|Escherichia coli M12|DNA utilization protein HofM
MAFKIWQIGLHLQQQEAVAVAIVRGTKECFLQRWWRLPLENDIIKDGRIVDAQRLAKTLLPWSRELPQRHHIMLAFPASRTLQRSFPRPSMSLGEREQTAWLSGTMARELDMDPDSLRFDYSEDSLSPAYNVTAAQSKELATLLTLAERLRVHVSAITPDASALQRFLPFLPSHQQCLAWRDNEQWLWATRYSWGRKLAVGITSAKELAAALSVDPESVAICGEGGFDPWEAVSVRQPPLPPPGGDFAIALGLALGKVY
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -2.18 | 6.8e-15 | ○○○○○ 0.09 | 0.09168611148396645 | 29101196 |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | 3.32 | 4.3e-32 | ○○○○○ 1.24 | 1.2390305438384543 | 29101196 |
Retrieved 2 of 2 entries in 1 ms
(Link to these results)