Bacterial taxon 1392858
Locus CO715_00605
Protein ATI04367.1
DNA-3-methyladenine glycosylase I
Escherichia coli M12
Length 187 aa, Gene n/a, UniProt n/a
>ATI04367.1|Escherichia coli M12|DNA-3-methyladenine glycosylase I
MERCGWVSQDPLYIAYHDNEWGVPETDSKKLFEMICLEGQQAGLSWITVLKKRENYRASFHQFDPVKVAAMQEEDVERLVQDAGIIRHRGKIQAIIGNARAYLQMEQNGEPFADFVWSFVNHQPQVTQATTLSEIPTSTPASDALSKALKKRGFKFVGTTICYSFMQACGLVNDHVVGCCCYPGNKP
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -10.72 | 4.3e-20 | ●●○○○ -1.69 | -1.6907767882440554 | 29101196 |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -2.58 | 0.0079 | ○○○○○ 0.01 | 0.007601767741675352 | 29101196 |
Retrieved 2 of 2 entries in 0.7 ms
(Link to these results)