Bacterial taxon 1392858
Locus CO715_20795
Protein ATI07946.1
DNA-damage-inducible protein I
Escherichia coli M12
Length 81 aa, Gene n/a, UniProt n/a
>ATI07946.1|Escherichia coli M12|DNA-damage-inducible protein I
MRIEVTIAKTSPLPAGAIDALAGELSRRIQYAFPDNEGHVSVRYAAANNLSVIGATKEDKQRISEILQETWESADDWFVSE
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -10.73 | 9.0e-12 | ●●○○○ -1.69 | -1.692445956358046 | 29101196 |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | 1.72 | 0.019 | ○○○○○ 0.9 | 0.9043623369832812 | 29101196 |
Retrieved 2 of 2 entries in 0.6 ms
(Link to these results)