Bacterial taxon 1392858
Locus CO715_02470
Protein ATI04697.1
DNA-directed RNA polymerase subunit omega
Escherichia coli M12
Length 91 aa, Gene n/a, UniProt n/a
>ATI04697.1|Escherichia coli M12|DNA-directed RNA polymerase subunit omega
MARVTVQDAVEKIGNRFDLVLVAARRARQMQVGGKDPLVPEENDKTTVIALREIEEGLINNQILDVRERQEQQEQEAAELQAVTAIAEGRR
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -11.49 | 4.3e-13 | ●●○○○ -1.85 | -1.8508082811729318 | 29101196 |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | 3.26 | 1.8e-6 | ○○○○○ 1.23 | 1.2256771989265274 | 29101196 |
Retrieved 2 of 2 entries in 0.7 ms
(Link to these results)