Bacterial taxon 1392858
Locus CO715_02805
Protein ATI04761.1
DUF1176 domain-containing protein
Escherichia coli M12
Length 347 aa, Gene n/a, UniProt n/a
>ATI04761.1|Escherichia coli M12|DUF1176 domain-containing protein
MRYRIFLLFFFALLPTSLVWAAPAQRAFSDWQVTCNNQNFCVARNTGDHNGLVMTLSRSAGAHTDAVLRIERGGLKSPDASEGEIAPRLLLDGEPLALSGDKWRISPWLLVTDDTATLTAFLQMIQEGKAITLRDGNQTISLSGLKAALLFIDAQQKRVGSETAWIKKGDEPPLSVPPAPALKEVAVVNPTPTPLSLEERNDLLDYGNWRMNGLRCSLDPLRREVNVTALTDDKALMMISCEAGAYNTIDLAWIVSRKKPLASRPVRLRLPFNSGQETNELELMNATFDEKSRELVTLAKGRGLSDCGIQARWRFDGQRFRLVRYAAEPTCDNWHGPDAWPTLWITR
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | 1.65 | 1.3e-69 | ○○○○○ 0.89 | 0.8893398239573629 | 29101196 |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | 1.78 | 1.1e-79 | ○○○○○ 0.92 | 0.9181329739237057 | 29101196 |
Retrieved 2 of 2 entries in 0.3 ms
(Link to these results)