Bacterial taxon 1392858
Locus CO715_01295
Protein ATI04487.1
DUF1190 domain-containing protein
Escherichia coli M12
Length 212 aa, Gene n/a, UniProt n/a
>ATI04487.1|Escherichia coli M12|DUF1190 domain-containing protein
MARKRKSRNNSKIGHGAISRIGRPNNPFEPRRNRYAQKYLTLALMGGAAFFVLKGCGDSGDVDNDGDGTFYSTVQDCIDDGNNSDICAHGWNNAKAAFYADVPKNMTQQNCQSKYENCYYDNVEQSWIPVVSGFLLSRVIRKDRDEQFVYNSGGSSFASRPVWRNTSGDYSWRSGSGKKESYSSGGFTTKKASTVSRGGYGRSSSARGHWGG
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -8.49 | 3.7e-7 | ●●○○○ -1.23 | -1.2252875304548458 | 29101196 |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -4.79 | 0.0027 | ●○○○○ -0.45 | -0.4522540476628149 | 29101196 |
Retrieved 2 of 2 entries in 1 ms
(Link to these results)